PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc01456.1.g00130.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family NAC
Protein Properties Length: 477aa    MW: 52236.8 Da    PI: 9.1688
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc01456.1.g00130.1.am.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM176.95.5e-551742991128
                           NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksg 81 
                                   lppGfrFhPtdeelv++yL++kv++  +++ ++i++vd++k+ePw+Lp+k++ +ekewyfFs rd+ky+tg r+nrat+sg
  Zpz_sc01456.1.g00130.1.am.mk 174 LPPGFRFHPTDEELVTYYLTHKVSDFAFTT-RAIADVDLNKCEPWELPSKASMGEKEWYFFSMRDRKYPTGIRTNRATDSG 253
                                   79*************************999.89***************999999*************************** PP

                           NAM  82 yWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                                   yWk+tgkdke+++  g lvg+kktLvfy+grapkg kt+Wvmheyrl
  Zpz_sc01456.1.g00130.1.am.mk 254 YWKTTGKDKEIFH-CGMLVGMKKTLVFYRGRAPKGGKTSWVMHEYRL 299
                                   *************.99*****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.83E-63168320IPR003441NAC domain
PROSITE profilePS5100559.459174320IPR003441NAC domain
PfamPF023651.4E-28175299IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 477 aa     Download sequence    Send to blast
MLPSSGRSEL SIGSPLTGFW SNNEDSATRG FSWLELAGNP SLHRGVNLKR RIDASSSLLS  60
TSPSPSPVIL AVVFGPRLKT KRIGQKEEER AARAGLVVYY CVALTSLHAR THAVRALVQL  120
LAFFRFRVFL CHYICAIAGA TVAATPAVAA DCALTHSLHA GRALRPRVVM EEGLPPGFRF  180
HPTDEELVTY YLTHKVSDFA FTTRAIADVD LNKCEPWELP SKASMGEKEW YFFSMRDRKY  240
PTGIRTNRAT DSGYWKTTGK DKEIFHCGML VGMKKTLVFY RGRAPKGGKT SWVMHEYRLQ  300
NKFPYKPNKE EWVVCRVFKK CQIIKVRPPT DSPTMDSPYH DGNASLGELD VSSILSNLTP  360
ASVHTSSSAP GEGFGHRVDM NAYMSWMAAA NQGAAAAAMI PWAMAPGLLG NVFAAPNQPY  420
AGCSPSQPRE IGGVVANVGG GQAMFVSSVA KVDMECDQQH QPPPQQLGID DSTWGAF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A1e-5417432017165NO APICAL MERISTEM PROTEIN
1ut4_B1e-5417432017165NO APICAL MERISTEM PROTEIN
1ut7_A1e-5417432017165NO APICAL MERISTEM PROTEIN
1ut7_B1e-5417432017165NO APICAL MERISTEM PROTEIN
3swm_A1e-5417432020168NAC domain-containing protein 19
3swm_B1e-5417432020168NAC domain-containing protein 19
3swm_C1e-5417432020168NAC domain-containing protein 19
3swm_D1e-5417432020168NAC domain-containing protein 19
3swp_A1e-5417432020168NAC domain-containing protein 19
3swp_B1e-5417432020168NAC domain-containing protein 19
3swp_C1e-5417432020168NAC domain-containing protein 19
3swp_D1e-5417432020168NAC domain-containing protein 19
4dul_A1e-5417432017165NAC domain-containing protein 19
4dul_B1e-5417432017165NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00364DAPTransfer from AT3G18400Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3631710.0AK363171.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2013D22.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004982400.11e-158PREDICTED: protein CUP-SHAPED COTYLEDON 1-like
TrEMBLK4ACC81e-158K4ACC8_SETIT; Uncharacterized protein
STRINGSi036535m1e-157(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP79193450
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18400.11e-89NAC domain containing protein 58